PDB entry 5kym

View 5kym on RCSB PDB site
Description: crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima
Deposited on 2016-07-21, released 2017-07-26
The last revision was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-acyl-sn-glycerol-3-phosphate acyltransferase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: Tmari_1701
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 1-acyl-sn-glycerol-3-phosphate acyltransferase
    Species: Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) [TaxId:243274]
    Gene: Tmari_1701
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HGX, DD9, LMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kymA (A:)
    mrkirnllltlyfyfiatvyivfyggfvlfrsflmrdrekarkyvlkeiekfgkraftwl
    fsdvvvegsenipkdrnfivvanhqslmdiplilgfvatgafiakeelrkipgvnwyiry
    lngvfldrknprravralreaieklkngvtfivfpegtrspdgkvlsfkkdslmiavktg
    vpvlpvsiwgtyhlipkgrwtftpgkvflkihepvdpkgfsseeelrkyveevvkrgvee
    lkarwsk
    

    Sequence, based on observed residues (ATOM records):
    >5kymA (A:)
    mrkirnllltlyfyfiatvyivfyggfvlfrsflmrdrekarkyvlkeiekfgkraftwl
    fsdvvvegsenipkdrnfivvanhqslmdiplilgfvatgafiakeelrkipgvnwyiry
    lngvflravralreaieklkngvtfivfpegtrspdgkvlsfkkdslmiavktgvpvlpv
    siwgtyhlipkgrwtftpgkvflkihepvdpkgfsseeelrkyveevvkrgveelkarws
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kymB (B:)
    mrkirnllltlyfyfiatvyivfyggfvlfrsflmrdrekarkyvlkeiekfgkraftwl
    fsdvvvegsenipkdrnfivvanhqslmdiplilgfvatgafiakeelrkipgvnwyiry
    lngvfldrknprravralreaieklkngvtfivfpegtrspdgkvlsfkkdslmiavktg
    vpvlpvsiwgtyhlipkgrwtftpgkvflkihepvdpkgfsseeelrkyveevvkrgvee
    lkarwsk
    

    Sequence, based on observed residues (ATOM records):
    >5kymB (B:)
    mrkirnllltlyfyfiatvyivfyggfvlfrsflmrdrekarkyvlkeiekfgkraftwl
    fsdvvvegsenipkdrnfivvanhqslmdiplilgfvatgafiaelrkipgvnwyiryln
    gvvralreaieklkngvtfivfpegtrspdgkvlsfkkdslmiavktgvpvlpvsiwgty
    hlipkgrwtftpgkvflkihepvdpkgfsseeelrkyveevvkrgveelkar