PDB entry 5ky9

View 5ky9 on RCSB PDB site
Description: mouse POFUT1 in complex with mouse Notch1 EGF12 mutant (D464G/A465G) and GDP
Class: transferase
Keywords: glycosyltransferase, TRANSFERASE
Deposited on 2016-07-21, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GDP-fucose protein O-fucosyltransferase 1
  Species: Mus musculus [TaxId:10090]
  Gene: Pofut1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91ZW2 (3-354)
    • expression tag (2)
• Chain 'B':
  Compound: Neurogenic locus notch homolog protein 1
  Species: Mus musculus [TaxId:10090]
  Gene: Notch1, Motch
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q01705 (Start-39)
    • engineered mutation (12-13)
  Domains in SCOPe 2.06: d5ky9b_
• Heterogens: NAG, GDP, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5ky9B (B:)
  dvnecisnpcqnggtcldqigefqcicmpgyegvyceint
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5ky9B (B:)
  ecisnpcqnggtcldqfqcicmpgyegvyceint