PDB entry 5ky9

View 5ky9 on RCSB PDB site
Description: mouse POFUT1 in complex with mouse Notch1 EGF12 mutant (D464G/A465G) and GDP
Class: transferase
Keywords: glycosyltransferase, TRANSFERASE
Deposited on 2016-07-21, released 2017-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-fucose protein O-fucosyltransferase 1
    Species: Mus musculus [TaxId:10090]
    Gene: Pofut1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91ZW2 (3-354)
      • expression tag (2)
  • Chain 'B':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Notch1, Motch
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01705 (Start-39)
      • engineered mutation (12-13)
    Domains in SCOPe 2.08: d5ky9b_
  • Heterogens: NAG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ky9B (B:)
    dvnecisnpcqnggtcldqigefqcicmpgyegvyceint
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ky9B (B:)
    ecisnpcqnggtcldqfqcicmpgyegvyceint