PDB entry 5ky6

View 5ky6 on RCSB PDB site
Description: Human muscle fructose-1,6-bisphosphate aldolase
Class: lyase
Keywords: aldolase, muscle, glycolysis, glyconeogenesis, lyase
Deposited on 2016-07-21, released 2017-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-bisphosphate aldolase A
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOA, ALDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ky6a_
  • Chain 'B':
    Compound: Fructose-bisphosphate aldolase A
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOA, ALDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ky6b_
  • Chain 'C':
    Compound: Fructose-bisphosphate aldolase A
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOA, ALDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ky6c_
  • Chain 'D':
    Compound: Fructose-bisphosphate aldolase A
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDOA, ALDA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ky6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ky6A (A:)
    pyqypaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkfsheeiamatvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfvsn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ky6A (A:)
    pyqypaltpeqkkelsdiahrivapgkgilaadestgsianteenrrfyrqllltaddrv
    npciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtngetttqgldg
    lsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqngivpivepe
    ilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghactqkfsheeia
    matvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfsygralqasa
    lkaaqeeyvkralanslacqgkyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ky6B (B:)
    pyqypaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkfsheeiamatvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfvsn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ky6B (B:)
    pyqypaltpeqkkelsdiahrivapgkgilaadestgsianteenrrfyrqllltaddrv
    npciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtngetttqgldg
    lsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqngivpivepe
    ilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghactqkfsheeia
    matvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfsygralqasa
    nlkaaqeeyvkralanslacqgkytpslfvsnhay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ky6C (C:)
    pyqypaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkfsheeiamatvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfvsn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ky6C (C:)
    pyqypaltpeqkkelsdiahrivapgkgilaadestgsianteenrrfyrqllltaddrv
    npciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtngetttqgldg
    lsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqngivpivepe
    ilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghactqkfsheeia
    matvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfsygralqasa
    nlkaaqeeyvkralanslacqgkytplfvsnhay
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ky6D (D:)
    pyqypaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
    llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
    etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
    givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
    qkfsheeiamatvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfs
    ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfvsn
    hay
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ky6D (D:)
    pyqypaltpeqkkelsdiahrivapgkgilaadestgsianteenrrfyrqllltaddrv
    npciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtngetttqgldg
    lsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqngivpivepe
    ilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghactqkfsheeia
    matvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfsygralqasa
    nlkaaqeeyvkralanslacqgkyt