PDB entry 5ky5

View 5ky5 on RCSB PDB site
Description: mouse pofut1 in complex with egf(+) and gdp
Deposited on 2016-07-21, released 2017-05-17
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-fucose protein O-fucosyltransferase 1
    Species: Mus musculus [TaxId:10090]
    Gene: Pofut1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: egf(+)
    Species: synthetic construct, synthetic [TaxId:32630]
    Gene: F7, Cf7
    Database cross-references and differences (RAF-indexed):
    • PDB 5KY5 (0-39)
  • Heterogens: NAG, GDP, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ky5A (A:)
    gapswdlagyllycpcmgrfgnqadhflgslafakllnrtlavppwieyqhhkppftnlh
    vsyqkyfkleplqayhrvvsledfmenlapshwppekrvaycfevaaqrspdkktcpmke
    gnpfgpfwdqfhvsfnkselftgisfsasykeqwtqrfpakehpvlalpgapaqfpvlee
    hrelqkymvwsdemvrtgealisahlvrpyvgihlrigsdwknacamlkdgtagshfmas
    pqcvgysrstatpltmtmclpdlkeiqravtlwvralnarsvyiatdsesyvseiqqlfk
    dkvrvvslkpevaqidlyilgqadhfigncvssftafvkrerdlhgrqssffgmd
    

    Sequence, based on observed residues (ATOM records):
    >5ky5A (A:)
    swdlagyllycpcmgrfgnqadhflgslafakllnrtlavppwieyqhhkppftnlhvsy
    qkyfkleplqayhrvvsledfmenlapshwppekrvaycfevaaqrspdkktcpmkegnp
    fgpfwdqfhvsfnkselftgisfsasykeqwtqrfpakehpvlalpgapaqfpvleehre
    lqkymvwsdemvrtgealisahlvrpyvgihlrigsdwknacamlkdgtagshfmaspqc
    vgysrstatpltmtmclpdlkeiqravtlwvralnarsvyiatdsesyvseiqqlfkdkv
    rvvslkpevaqidlyilgqadhfigncvssftafvkrerdlhgrqssffgmd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5ky5B (B:)
    didecasnpcqnggtcvntvgsytclcppgftgpnceddi