PDB entry 5ky2

View 5ky2 on RCSB PDB site
Description: mouse POFUT1 in complex with O-glucosylated mouse Factor VII EGF1 and GDP
Class: transferase
Keywords: glycosyltransferase, TRANSFERASE
Deposited on 2016-07-20, released 2017-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-fucose protein O-fucosyltransferase 1
    Species: Mus musculus [TaxId:10090]
    Gene: Pofut1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91ZW2 (3-354)
      • expression tag (0-2)
  • Chain 'B':
    Compound: Coagulation factor VII
    Species: Mus musculus [TaxId:10090]
    Gene: F7, Cf7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ky2b_
  • Heterogens: NAG, GDP, GOL, BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ky2B (B:)
    dgdqcasnpcqnggtcqdhlksyvcfclldfegrnceksk