PDB entry 5kxh

View 5kxh on RCSB PDB site
Description: mouse POFUT1 in complex with mouse Factor VII EGF1 and GDP
Class: transferase
Keywords: glycosyltransferase O-fucosylation GT-B inverting, transferase
Deposited on 2016-07-20, released 2017-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-fucose protein O-fucosyltransferase 1
    Species: Mus musculus [TaxId:10090]
    Gene: Pofut1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91ZW2 (3-354)
      • expression tag (2)
  • Chain 'B':
    Compound: Coagulation factor VII
    Species: Mus musculus [TaxId:10090]
    Gene: F7, Cf7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kxhb_
  • Heterogens: NAG, GDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kxhB (B:)
    dgdqcasnpcqnggtcqdhlksyvcfclldfegrnceksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxhB (B:)
    dqcasnpcqnggtcqdhlksyvcfclldfegrnceksk