PDB entry 5kxe

View 5kxe on RCSB PDB site
Description: Wisteria floribunda lectin in complex with GalNAc(beta1-4)GlcNAc (LacdiNAc) at pH 4.2
Class: sugar binding protein/inhibitor
Keywords: Carbohydrate-binding protein, lectin, sugar binding protein-inhibitor complex
Deposited on 2016-07-20, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXE (0-End)
    Domains in SCOPe 2.06: d5kxea_
  • Chain 'B':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXE (0-End)
    Domains in SCOPe 2.06: d5kxeb_
  • Chain 'C':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXE (0-End)
    Domains in SCOPe 2.06: d5kxec_
  • Chain 'D':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXE (0-End)
    Domains in SCOPe 2.06: d5kxed_
  • Heterogens: NAG, FUC, BMA, MAN, 6Y2, MN, CA, PO4, XYP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kxeA (A:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxeA (A:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kxeB (B:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxeB (B:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kxeC (C:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxeC (C:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kxeD (D:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxeD (D:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps