PDB entry 5kxd

View 5kxd on RCSB PDB site
Description: Wisteria floribunda lectin in complex with GalNAc(beta1-4)GlcNAc (LacdiNAc) at pH 6.5
Class: sugar binding protein
Keywords: Carbohydrate-binding protein, lectin, SUGAR BINDING PROTEIN
Deposited on 2016-07-20, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXD (0-End)
    Domains in SCOPe 2.06: d5kxda_
  • Chain 'B':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXD (0-End)
    Domains in SCOPe 2.06: d5kxdb_
  • Chain 'C':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXD (0-End)
    Domains in SCOPe 2.06: d5kxdc_
  • Chain 'D':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXD (0-End)
    Domains in SCOPe 2.06: d5kxdd_
  • Heterogens: NAG, FUC, CA, MN, ACT, 6Y2, BMA, XYP, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kxdA (A:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxdA (A:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kxdB (B:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxdB (B:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kxdC (C:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxdC (C:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kxdD (D:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxdD (D:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps