PDB entry 5kxc

View 5kxc on RCSB PDB site
Description: Wisteria floribunda lectin in complex with GalNAc(beta1-4)GlcNAc (LacdiNAc) at pH 8.5.
Class: sugar binding protein
Keywords: Carbohydrate-binding protein, lectin, SUGAR BINDING PROTEIN
Deposited on 2016-07-20, released 2016-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-14, with a file datestamp of 2016-09-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXC (0-End)
    Domains in SCOPe 2.06: d5kxca_
  • Chain 'B':
    Compound: isteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXC (0-End)
    Domains in SCOPe 2.06: d5kxcb_
  • Chain 'C':
    Compound: isteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXC (0-End)
    Domains in SCOPe 2.06: d5kxcc_
  • Chain 'D':
    Compound: isteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXC (0-End)
    Domains in SCOPe 2.06: d5kxcd_
  • Heterogens: NAG, FUC, 6Y2, CA, MN, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kxcA (A:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxcA (A:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kxcB (B:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxcB (B:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kxcC (C:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxcC (C:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kxcD (D:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxcD (D:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps