PDB entry 5kxb

View 5kxb on RCSB PDB site
Description: Wisteria floribunda lectin in complex with GalNAc
Class: sugar binding protein
Keywords: Carbohydrate-binding protein, lectin, SUGAR BINDING PROTEIN
Deposited on 2016-07-20, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXB (0-End)
    Domains in SCOPe 2.07: d5kxba_
  • Chain 'B':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXB (0-End)
    Domains in SCOPe 2.07: d5kxbb_
  • Chain 'C':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXB (0-End)
    Domains in SCOPe 2.07: d5kxbc_
  • Chain 'D':
    Compound: Wisteria floribunda agglutinin
    Species: Wisteria floribunda [TaxId:3922]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KXB (0-End)
    Domains in SCOPe 2.07: d5kxbd_
  • Heterogens: NAG, FUC, BMA, XYP, MAN, NGA, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kxbA (A:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxbA (A:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kxbB (B:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxbB (B:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kxbC (C:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxbC (C:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kxbD (D:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdpssd
    dcn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kxbD (D:)
    kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
    sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
    ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
    vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps