PDB entry 5kx5

View 5kx5 on RCSB PDB site
Description: Crystal structure of tubulin-stathmin-TTL-Compound 11 complex
Class: structural protein/inhibitor
Keywords: Tubulin Tubulysin, STRUCTURAL PROTEIN-INHIBITOR complex
Deposited on 2016-07-20, released 2016-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kx5b1, d5kx5b2
  • Chain 'C':
    Compound: Tubulin alpha chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kx5c1, d5kx5c2
  • Chain 'D':
    Compound: Tubulin beta chain
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kx5d1, d5kx5d2
  • Chain 'E':
    Compound: Stathmin-4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: STMN4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63043
      • conflict (11)
      • conflict (17)
    Domains in SCOPe 2.06: d5kx5e_
  • Chain 'F':
    Compound: Ttl protein
    Species: Gallus gallus [TaxId:9031]
    Gene: TTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1BQ43 (0-377)
      • expression tag (378-379)
    Domains in SCOPe 2.06: d5kx5f1, d5kx5f2, d5kx5f3
  • Heterogens: GTP, MG, CA, GDP, 6YK, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kx5B (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kx5B (B:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgyraltvpeltqqmfdsknmmaac
    dprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
    satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
    qyqdata
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kx5C (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsvegegeeegeey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kx5C (C:)
    mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
    hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
    rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
    vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
    slrfdgalnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepan
    qmvkcdprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyqpp
    tvvpggdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefse
    aredmaalekdyeevgvdsv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kx5D (D:)
    mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
    prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
    rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
    epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
    rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmm
    aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
    lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
    eyqqyqdatadeqgefeeeegedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kx5D (D:)
    reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
    railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
    kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
    pynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttclr
    fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqltvpeltqqmfdsknmmaacdp
    rhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsa
    tfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqy
    qdatad
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5kx5E (E:)
    madmevielnkatsgqswevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrk
    yqeaellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamler
    lqekdkhaeevrknkelkeeasr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kx5E (E:)
    mevielnkatsgqswevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
    eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
    e
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5kx5F (F:)
    mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
    lvnyyrgadklcrkaslvkliktspelsesctwfpesyviyptnlktpvapaqngirhli
    nntrtderevflaaynrrregregnvwiakssagakgegilisseaselldfideqgqvh
    viqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchl
    tnhciqkeysknygryeegnemffeefnqylmdalnttlensillqikhiirsclmciep
    aistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfp
    ladtgqktsqptsifiklhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kx5F (F:)
    mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
    lvnyyrgadklcrkaslvkliktspelsesctwfpesyviyptderevflaaynrrregr
    egnvwiakssilisseaselldfidevhviqkylekplllepghrkfdirswvlvdhlyn
    iylyregvlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylm
    dalnttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwliev
    ngapacaqklyaelcqgivdvaissvfplasifiklhh