PDB entry 5kvy

View 5kvy on RCSB PDB site
Description: crystal structure of the two tandem rrm domains of puf60 bound to a portion of an adml pre-mrna 3' splice site analog
Deposited on 2016-07-15, released 2017-08-23
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(U)-binding-splicing factor PUF60
    Species: Homo sapiens [TaxId:9606]
    Gene: PUF60, FIR, ROBPI, SIAHBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHX1 (17-End)
      • expression tag (14-16)
      • engineered mutation (22)
      • engineered mutation (28)
      • engineered mutation (154)
  • Chain 'B':
    Compound: Poly(U)-binding-splicing factor PUF60
    Species: Homo sapiens [TaxId:9606]
    Gene: PUF60, FIR, ROBPI, SIAHBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHX1 (17-End)
      • expression tag (13-16)
      • engineered mutation (22)
      • engineered mutation (28)
      • engineered mutation (154)
  • Chain 'C':
    Compound: DNA (30-mer)
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kvyA (A:)
    gshmasmtggqqmgrgsaaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidm
    swdsvtmkhkgfafveyevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlae
    earafnriyvasvhqdlsdddiksvfeafgkiksatlardpttgkhkgygfieyekaqss
    qdavssmnlfdlggqylrvgkavtppmplltpatpg
    

    Sequence, based on observed residues (ATOM records):
    >5kvyA (A:)
    rgsaaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfaf
    veyevpeaaqlaleqmnsvmlggrnikvgrpsniqaqpiidqlaeearafnriyvasvhq
    dlsdddiksvfeafgkiksatlardpttgkhkgygfieyekaqssqdavssmnlfdlggq
    ylrvgkavtppmpll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kvyB (B:)
    gshmasmtggqqmgrgsaaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidm
    swdsvtmkhkgfafveyevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlae
    earafnriyvasvhqdlsdddiksvfeafgkiksatlardpttgkhkgygfieyekaqss
    qdavssmnlfdlggqylrvgkavtppmplltpatpg
    

    Sequence, based on observed residues (ATOM records):
    >5kvyB (B:)
    grgsaaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidmswdsvtmkhkgfa
    fveyevpeaaqlaleqmnsvmlggrnikvgrpsnqaqpiidqlaeearafnriyvasvhq
    dlsdddiksvfeafgkiksatlardpttgkhkgygfieyekaqssqdavssmnlfdlggq
    ylrvgkavtppmpll
    

  • Chain 'C':
    No sequence available.