PDB entry 5kvv

View 5kvv on RCSB PDB site
Description: Structure of Malate Dehydrogenase in complex with NADH from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: KREBS CYCLE, OXIDOREDUCTASE, Structural Genomics, TB Structural Genomics Consortium, TBSGC
Deposited on 2016-07-15, released 2016-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: mdh, Rv1240, MTV006.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kvva1, d5kvva2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: mdh, Rv1240, MTV006.12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kvvb1, d5kvvb2
  • Heterogens: NAI, GOL, TRS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kvvA (A:)
    hhhhhhvsasplkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegv
    vmelddcafpllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqg
    kalnavaaddvrvgvtgnpantnaliamtnapdiprerfsaltrldhnraisqlaaktga
    avtdikkmtiwgnhsatqypdlfhaevagknaaevvndqawiedefiptvakrgaaiida
    rgassaasaasatidaardwllgtpaddwvsmavvsdgsygvpeglissfpvttkggnwt
    ivsgleidefsrgridkstaeladersavtelgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kvvA (A:)
    asplkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddca
    fpllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnavaa
    ddvrvgvtgnpantnaliamtnapdiprerfsaltrldhnraisqlaaktgaavtdikkm
    tiwgnhsatqypdlfhaevagknaaevvndqawiedefiptvakrgaaiidargassaas
    aasatidaardwllgtpaddwvsmavvsdgsygvpeglissfpvttkggnwtivsgleid
    efsrgridkstaeladersavtelgli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kvvB (B:)
    hhhhhhvsasplkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegv
    vmelddcafpllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqg
    kalnavaaddvrvgvtgnpantnaliamtnapdiprerfsaltrldhnraisqlaaktga
    avtdikkmtiwgnhsatqypdlfhaevagknaaevvndqawiedefiptvakrgaaiida
    rgassaasaasatidaardwllgtpaddwvsmavvsdgsygvpeglissfpvttkggnwt
    ivsgleidefsrgridkstaeladersavtelgli
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kvvB (B:)
    splkvavtgaagqigysllfrlasgsllgpdrpielrlleiepalqalegvvmelddcaf
    pllsgveigsdpqkifdgvslallvgarprgagmersdlleangaiftaqgkalnavaad
    dvrvgvtgnpantnaliamtnapdiprerfsaltrldhnraisqlaaktgaavtdikkmt
    iwgnhsatqypdlfhaevagknaaevvndqawiedefiptvakrgaaiidargassaasa
    asatidaardwllgtpaddwvsmavvsdgsygvpeglissfpvttkggnwtivsgleide
    fsrgridkstaeladersavtelgli