PDB entry 5kvt

View 5kvt on RCSB PDB site
Description: the structure of trka kinase domain bound to the inhibitor entrectinib
Class: transferase/transferase inhibitor
Keywords: KINASE, TRANSFERASE-TRANSFERASE INHIBITOR COMPLEX, TRANSFERASE-TRANSFER complex
Deposited on 2016-07-15, released 2017-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-27, with a file datestamp of 2017-12-22.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high affinity nerve growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: NTRK1, MTC, TRK, TRKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04629 (0-286)
      • expression tag (287-290)
    Domains in SCOPe 2.07: d5kvta1, d5kvta2
  • Heterogens: YMX, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kvtA (A:)
    cvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalkeasesarqdfqre
    aelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdakllaggedvapg
    plglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgmsrdiystdy
    yrvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidci
    tqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kvtA (A:)
    cvhhikrrdivlkwelgegafgkvflaechnldkmlvavkalkeasesarqdfqreaell
    tmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpdakllaggedvapgplgl
    gqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfgmsrdiystdyyrvg
    grtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidcitqgr
    elerpracppevyaimrgcwqrepqqrhsikdvharlqalaqahhhh