PDB entry 5kva

View 5kva on RCSB PDB site
Description: Crystal Structure of sorghum caffeoyl-CoA O-methyltransferase (CCoAOMT)
Class: transferase
Keywords: caffeoyl-CoA O-methyltransferase, SbCCoAOMT, CCoAOMT, CCOMT OMT, SAM O-methyltransferase, methyltransferase, Coenzyme A, TRANSFERASE
Deposited on 2016-07-14, released 2016-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caffeoyl-CoA O-methyltransferase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Gene: Sb10g004540, SORBIDRAFT_10g004540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kvaa_
  • Chain 'B':
    Compound: Caffeoyl-CoA O-methyltransferase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Gene: Sb10g004540, SORBIDRAFT_10g004540
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kvab_
  • Heterogens: SAM, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kvaA (A:)
    mhhhhhhssgtddddkamattateaakaapaeqangnangeqktrhsevghksllksddl
    yqyildtsvyprepesmkelreitakhpwnlmttsadegqflnmlikligakktmeigvy
    tgysllatalalpedgtilamdinrenyelglpciekagvahkidfregpalpvlddlia
    deknhgsfdfvfvdadkdnylnyhdrllklvklggligydntlwngsvvlpddapmrkyi
    rfyrdfvlvlnkalaaderveicqlpvgdgvtlcrrvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kvaA (A:)
    ksllksddlyqyildtsvyprepesmkelreitakhpwnlmttsadegqflnmlikliga
    kktmeigvytgysllatalalpedgtilamdinrenyelglpciekagvahkidfregpa
    lpvlddliadeknhgsfdfvfvdadkdnylnyhdrllklvklggligydntlwngsvvlp
    ddapmrkyirfyrdfvlvlnkalaaderveicqlpvgdgvtlcrrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kvaB (B:)
    mhhhhhhssgtddddkamattateaakaapaeqangnangeqktrhsevghksllksddl
    yqyildtsvyprepesmkelreitakhpwnlmttsadegqflnmlikligakktmeigvy
    tgysllatalalpedgtilamdinrenyelglpciekagvahkidfregpalpvlddlia
    deknhgsfdfvfvdadkdnylnyhdrllklvklggligydntlwngsvvlpddapmrkyi
    rfyrdfvlvlnkalaaderveicqlpvgdgvtlcrrvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kvaB (B:)
    hksllksddlyqyildtsvyprepesmkelreitakhpwnlmttsadegqflnmliklig
    akktmeigvytgysllatalalpedgtilamdinrenyelglpciekagvahkidfregp
    alpvlddliadeknhgsfdfvfvdadkdnylnyhdrllklvklggligydntlwngsvvl
    pddapmrkyirfyrdfvlvlnkalaaderveicqlpvgdgvtlcrrvk