PDB entry 5kv9

View 5kv9 on RCSB PDB site
Description: Crystal structure of a hPIV haemagglutinin-neuraminidase-inhibitor complex
Class: hydrolase/inhibitor
Keywords: haemagglutinin-neuraminidase, hyrdrolase, viral protein, host cell surface receptor binding, HYDROLASE-INHIBITOR complex
Deposited on 2016-07-13, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: hemagglutinin-neuraminidase
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kv9b_
  • Heterogens: CA, NAG, I57, EDO, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kv9B (B:)
    rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
    liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
    lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
    svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
    iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit
    dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk
    srvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqp
    mlfkteipkscshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kv9B (B:)
    rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
    liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
    lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
    svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
    iivvdknsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditdy
    sdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqksr
    vnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpml
    fkteipkscs