PDB entry 5kuy

View 5kuy on RCSB PDB site
Description: influenza hemagglutinin h3 a/hong kong/1/1968 in complex with designed inhibitor protein hsb.2a
Deposited on 2016-07-13, released 2017-06-14
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (0-3)
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-175)
      • engineered mutation (122)
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • engineered mutation (122)
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (4-End)
      • expression tag (2-3)
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-End)
      • engineered mutation (122)
  • Chain 'G':
    Compound: Designed influenza inhibitor HSB.2A
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KUY
  • Chain 'H':
    Compound: Designed influenza inhibitor HSB.2A
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KUY
  • Chain 'I':
    Compound: Designed influenza inhibitor HSB.2A
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KUY
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kuyA (A:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records):
    >5kuyA (A:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kuyB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgvs
    

    Sequence, based on observed residues (ATOM records):
    >5kuyB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kuyC (C:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records):
    >5kuyC (C:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kuyD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgvs
    

    Sequence, based on observed residues (ATOM records):
    >5kuyD (D:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5kuyE (E:)
    adpgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
    idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
    wtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
    tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
    sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records):
    >5kuyE (E:)
    pgatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5kuyF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgvs
    

    Sequence, based on observed residues (ATOM records):
    >5kuyF (F:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5kuyG (G:)
    mgivnvpncnttkyqqlartavaiynyheqahltfvenlnckeqgnyyyitlaatddagk
    kaiyeakigvvesagwtgveefklvgslegshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kuyG (G:)
    ivnvpncnttkyqqlartavaiynyheqahltfvenlnckeqgnyyyitlaatddagkka
    iyeakigvvesagwtgveefklvg
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5kuyH (H:)
    mgivnvpncnttkyqqlartavaiynyheqahltfvenlnckeqgnyyyitlaatddagk
    kaiyeakigvvesagwtgveefklvgslegshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kuyH (H:)
    ivnvpncnttkyqqlartavaiynyheqahltfvenlnckeqgnyyyitlaatddagkka
    iyeakigvvesagwtgveefklvgs
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5kuyI (I:)
    mgivnvpncnttkyqqlartavaiynyheqahltfvenlnckeqgnyyyitlaatddagk
    kaiyeakigvvesagwtgveefklvgslegshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kuyI (I:)
    cntkyqqlartavaiynyheqahltfvenyyyitlaakigvvesagwtgveef