PDB entry 5ku3

View 5ku3 on RCSB PDB site
Description: brd4 bromodomain in complex with cpd59 ((s)-1-(3-((2-fluoro-4-(1- methyl-1h-pyrazol-4-yl)phenyl)amino)-1-(tetrahydrofuran-3-yl)-6,7- dihydro-1h-pyrazolo[4,3-c]pyridin-5(4h)-yl)ethanone)
Deposited on 2016-07-12, released 2016-11-02
The last revision was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, DMS, GOL, PEG, 6XH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5ku3A (A:)
    stnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
    ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
    nelpte