PDB entry 5ktw

View 5ktw on RCSB PDB site
Description: CREBBP bromodomain in complex with Cpd 44 (3-((5-acetyl-1-(cyclopropylmethyl)-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl)amino)-N-isopropylbenzamide)
Class: transferase
Keywords: CREBBP bromodomain, TRANSFERASE
Deposited on 2016-07-12, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (2-113)
      • expression tag (0-1)
      • conflict (112)
    Domains in SCOPe 2.07: d5ktwa1, d5ktwa2
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (2-113)
      • expression tag (0-1)
      • conflict (112)
    Domains in SCOPe 2.07: d5ktwb1, d5ktwb2
  • Chain 'C':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (2-113)
      • expression tag (0-1)
      • conflict (112)
    Domains in SCOPe 2.07: d5ktwc1, d5ktwc2
  • Heterogens: 6XG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ktwA (A:)
    aafkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ktwB (B:)
    aafkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ktwC (C:)
    aafkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqal