PDB entry 5ktp

View 5ktp on RCSB PDB site
Description: Crystal structure of Pyrococcus horikoshii quinolinate synthase (NadA) with bound itaconate and Fe4S4 cluster
Class: transferase
Keywords: Dehydratase, iron-sulfur cluster, substrate analog complex, biosynthetic enzyme, TRANSFERASE
Deposited on 2016-07-12, released 2016-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Quinolinate synthase A
    Species: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) [TaxId:70601]
    Gene: nadA, PH0013
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ktpa_
  • Heterogens: SF4, CL, ITN, NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ktpA (A:)
    gsftmdlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfa
    gvdfmaetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaea
    kayadvtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkf
    tlddverakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvy
    rlrklypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaierml
    emsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ktpA (A:)
    dlveeilrlkeernaiilahnyqlpevqdiadfigdslelarratrvdadvivfagvdfm
    aetakilnpdkvvlipsreatcamanmlkvehileakrkypnapvvlyvnstaeakayad
    vtvtsanavevvkkldsdvvifgpdknlahyvakmtgkkiipvpskghcyvhqkftlddv
    erakklhpnaklmihpecipevqekadiiastggmikracewdewvvfteremvyrlrkl
    ypqkkfyparedafcigmkaitlkniyeslkdmkykvevpeeiarkarkaiermlem