PDB entry 5ktk

View 5ktk on RCSB PDB site
Description: ketoreductase from module 3 of the bacillaene synthase from bacillus subtilis 168
Deposited on 2016-07-11, released 2016-09-07
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyketide synthase PksJ
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: pksJ, pksK, BSU17180
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NDP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ktkA (A:)
    serdkkelvnaiedraacfltkqwslspigsavpgtrtvailccqetadlaaevssyfpn
    hllidvsriendqsdidwkefdglvdvigcgwddegrldwiewvqrlvefghkeglrllc
    vtkglesfqntsvrmagasraglyrmlqceyshlisrhmdaeevtdhrrlakliadefys
    dsydaevcyrdglryqaflkahpetgkateqsavfpkdhvllitggtrgigllcarhfae
    cygvkklvltgreqlppreewarfktsntslaekiqavreleakgvqvemlsltlsddaq
    veqtlqhikrtlgpiggvihcagltdmdtlafirktsddiqrvlepkvsglttlyrhvcn
    eplqffvlfssvsaiipelsagqadyamansymdyfaeahqkhapiisvqwpnwketgmg
    evtnqayrdsgllsitnseglrfldqivskkfgpvvlpamanqtnwepellmkrrkpheg
    glqeaalqsppardieeadevskcdgllsetqswlidlf
    

    Sequence, based on observed residues (ATOM records):
    >5ktkA (A:)
    draacfltkqwslspigsavpgtrtvailccqetadlaaevssyfpnhllidvsrqsdid
    wkefdglvdvigcgwddegrldwiewvqrlvefghkeglrllcvtkglesfqntsvrmag
    asraglyrmlqceyshlisrhmdaeevtdhrrlakliadefysdsydaevcyrdglryqa
    flkahpetgqsavfpkdhvllitggtrgigllcarhfaecygvkklvltgreqlppreew
    arfktsntslaekiqavreleakgvqvemlsltlsddaqveqtlqhikrtlgpiggvihc
    agltdmdtlafirktsddiqrvlepkvsglttlyrhvcneplqffvlfssvsaiipelsa
    gqadyamansymdyfaeahqkhapiisvqwpnwketgmgevtnqayrdsgllsitnsegl
    rfldqivskkfgpvvlpamanqtnwepellmk