PDB entry 5ktf

View 5ktf on RCSB PDB site
Description: structure of the c-terminal transmembrane domain of scavenger receptor bi (sr-bi)
Deposited on 2016-07-11, released 2017-03-08
The last revision was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scavenger receptor class B member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Scarb1, Srb1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61009 (2-72)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5ktfA (A:)
    gskiepvvlpllwfeqsgamggkplstfytqlvlmpqvlhyaqyvllglggllllvpiic
    qlrsqekcflfws