PDB entry 5ktb

View 5ktb on RCSB PDB site
Description: structure of a complex between s. cerevisiae csm1 and mam1
Deposited on 2016-07-11, released 2016-07-20
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Monopolin complex subunit CSM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CSM1, SPO86, YCR086W, YCR86W
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Monopolin complex subunit MAM1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAM1, YER106W
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5ktbA (A:)
    mdpltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkel
    ktqtsqqaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdykl
    gfvkgqaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiaksln
    kkrekkdete
    

    Sequence, based on observed residues (ATOM records):
    >5ktbA (A:)
    llvanlvnenfvlsekldtkateikqlqkqidslnaqvkelktqtsqqaensevikdlye
    ylcnvrvhksyeddsglwfdisqgthsdysimdyklgfvvteviyapvlkqrsteelysl
    qsklpeylfetlsfplsslnqfynkiaksln
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5ktbB (B:)
    mdpltvyknsvkqqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkel
    ktqtsqqaensevikdlyeylcnvrvhksyeddsglwfdisqgthsggssddysimdykl
    gfvkgqaqvteviyapvlkqrsteelyslqsklpeylfetlsfplsslnqfynkiaksln
    kkrekkdete
    

    Sequence, based on observed residues (ATOM records):
    >5ktbB (B:)
    qqidsadllvanlvnenfvlsekldtkateikqlqkqidslnaqvkelktqtsqqaense
    vikdlyeylcnvrvhksyeddsglwfdisqgtsimdyklgfvkaqvteviyapvlkqrst
    eelyslqsklpeylfetlsfplsslnqfynkiakslnk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5ktbC (C:)
    qkkrflpqsvlikredeiafddfhldarkvlndlsatsenpfssspntkkikskgktlev
    vpkkknkkii
    

    Sequence, based on observed residues (ATOM records):
    >5ktbC (C:)
    kkrflpqsvlikredeiafddfhldarkvlndlsatsenpfs