PDB entry 5kt4

View 5kt4 on RCSB PDB site
Description: teranry complex of human dna polymerase iota r96g inserting dcmpnpp opposite template g in the presence of mg2+
Deposited on 2016-07-11, released 2016-08-31
The last revision was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase iota
    Species: Homo sapiens [TaxId:9606]
    Gene: POLI, RAD30B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNA4
      • engineered mutation (95)
  • Chain 'P':
    Compound: DNA (5'-d(p*ap*gp*gp*ap*cp*cp*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: DNA (5'-d(*cp*tp*gp*gp*gp*gp*tp*cp*cp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: 0KX, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kt4A (A:)
    meklgvepeeegggdddeedaeawameladvgaaassqgvhdqvlptpnassrvivhvdl
    dcfyaqvemisnpelkdkplgvqqkylvvtcnyeagklgvkklmnvrdakekcpqlvlvn
    gedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqsdelsavtvsg
    hvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkllaklvsgvfkp
    nqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfspkilekelgi
    svaqriqklsfgednspvilsgppqsfseedsfkkcsseveaknkieellasllnrvcqd
    grkphtvrliirryssekhygresrqcpipshviqklgtgnydvmtpmvdilmklfrnmv
    nvkmpfhltllsvcfcnlkalntak
    

    Sequence, based on observed residues (ATOM records):
    >5kt4A (A:)
    ssrvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyeagklgvkklmnvrdak
    ekcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqs
    delsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkll
    aklvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfs
    pkilekelgisvaqriqklsfgednspvilsgppqsfseedsfkkcsseveaknkieell
    asllnrvcqdgrkphtvrliirrygresrqcpipshviqklgydvmtpmvdilmklfrnm
    vnvkfhltllsvcfcnlk
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.