PDB entry 5kt1

View 5kt1 on RCSB PDB site
Description: The crystal structure of 4-methylthiobenzoate-bound CYP199A4
Class: oxidoreductase
Keywords: P450, Oxidoreductase, Substrate
Deposited on 2016-07-11, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Rhodopseudomonas palustris (strain HaA2) [TaxId:316058]
    Gene: RPB_3613
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kt1a_
  • Heterogens: 4MI, HEM, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kt1A (A:)
    tiphlaidpfsldffddpypdqqtlrdagpvvyldkwnvygvaryaevhavlndpttfcs
    srgvglsdfkkekpwrppslileadppahtrpravlskvlspatmktirdgfaaaadakv
    dellqrgcidaiadlaeayplsvfpdamglkqegrehllpyaglvfnafgppnelrqtai
    ersaphqayvneqcqrpnlapggfgacihaftdtgeitpdeapllvrsllsagldttvng
    igaavyclarfpgelqrlrsdptlarnafeeavrfespvqtffrtttrevelggavigeg
    ekvlmflgsanrdprrwsdpdlyditrktsghvgfgsgvhmcvgqlvarlegevmlsala
    rkvaaididgpvkrrfnntlrgleslpvkltpa