PDB entry 5kt0

View 5kt0 on RCSB PDB site
Description: dihydrodipicolinate reductase from the industrial and evolutionarily important cyanobacteria anabaena variabilis.
Deposited on 2016-07-10, released 2016-09-07
The last revision was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxy-tetrahydrodipicolinate reductase
    Species: Anabaena variabilis (strain ATCC 29413 / PCC 7937) [TaxId:240292]
    Gene: dapB, Ava_0474
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kt0A (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdptnqapipvivngaagkmgrevvkaiaq
    apdlnllgaidsspehqgkdagelaglseplevpitnqlepmlgyvagerqgppgvivdf
    thpdsvydnvrsaiaygirpvvgttglspaqiqnladfaekastgcliipnfsigmvllq
    qaavtasqyfdhveiielhhnqkadapsgtaiqtaellaelgktfnsaiveetekipgar
    gslagegirihsvrlpgliahqevifgapgqiytlrhdtsdracympgvllairkvlqlk
    slvyglekil
    

    Sequence, based on observed residues (ATOM records):
    >5kt0A (A:)
    apipvivngaagkmgrevvkaiaqapdlnllgaidsspehqgkdagelaglseplevpit
    nqlepmlgyvagerqgppgvivdfthpdsvydnvrsaiaygirpvvgttglspaqiqnla
    dfaekastgcliipnfsigmvllqqaavtasqyfdhveiielhhnqkadapsgtaiqtae
    llaelgktfnsaiveetekipgargslagegirihsvrlpgliahqevifgapgqiytlr
    hdtsdracympgvllairkvlqlkslvyglekil