PDB entry 5kss

View 5kss on RCSB PDB site
Description: Stationary phase survival protein E (SurE) from Xylella fastidiosa - XFSurE-Ds (Dimer Smaller)
Class: hydrolase
Keywords: Stationary phase survival protein E (SurE), Xylella fastidiosa, crystallization., HYDROLASE
Deposited on 2016-07-09, released 2017-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.82 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase sure
    Species: Xylella fastidiosa (strain 9a5c) [TaxId:160492]
    Gene: surE, XF_0858
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kssa_
  • Chain 'B':
    Compound: 5'-nucleotidase sure
    Species: Xylella fastidiosa (strain 9a5c) [TaxId:160492]
    Gene: surE, XF_0858
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kssb_
  • Heterogens: MN, IOD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kssA (A:)
    mrvlvsnddgvdapgikiladalrnaghevmvvapdrdrsgasnsltldtpirakqidmh
    tysvagtptdcvhlaltgllnydpdivvsginntgnlgddviysgtvsaamegrflglpa
    vavslvtlyregqqapqyetaahaainivaqlktdplpadtilnvnvpdvtwqqmrgfkv
    trlgnrhrsapcltqtdprghtiywigpagpeqdagpgtdfdavrntyisitpihvdltr
    yqalenvtrwtdrltahmdwptlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kssA (A:)
    mrvlvsnddgvdapgikiladalrnaghevmvvapdrdrsgasnsltldtpirakqidmh
    tysvagtptdcvhlaltgllnydpdivvsginntgnlgddviysgtvsaamegrflglpa
    vavslvtlyqqapqyetaahaainivaqlktdplpadtilnvnvpdvtwqqmrgfkvtrl
    gnrhrsapcltqtdprghtiywigpagpeqdagpgtdfdavrntyisitpihvdltryqa
    lenvtrwtdrlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kssB (B:)
    mrvlvsnddgvdapgikiladalrnaghevmvvapdrdrsgasnsltldtpirakqidmh
    tysvagtptdcvhlaltgllnydpdivvsginntgnlgddviysgtvsaamegrflglpa
    vavslvtlyregqqapqyetaahaainivaqlktdplpadtilnvnvpdvtwqqmrgfkv
    trlgnrhrsapcltqtdprghtiywigpagpeqdagpgtdfdavrntyisitpihvdltr
    yqalenvtrwtdrltahmdwptlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kssB (B:)
    mrvlvsnddgvdapgikiladalrnaghevmvvapdrdrsgasnsltldtpirakqidmh
    tysvagtptdcvhlaltgllnydpdivvsginntgnlgddviysgtvsaamegrflglpa
    vavslvtlapqyetaahaainivaqlktdplpadtilnvnvpdvtwqqmrgfkvtrlgnr
    hrsapcltqtdprghtiywigpaeqdagpgtdfdavrntyisitpihvdltryqalenvt
    rwtdrltah