PDB entry 5ksp

View 5ksp on RCSB PDB site
Description: hmiro1 c-domain gdp complex c2221 crystal form
Deposited on 2016-07-08, released 2016-09-21
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial Rho GTPase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOT1, ARHT1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Mitochondrial Rho GTPase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RHOT1, ARHT1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GDP, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kspA (A:)
    kkqtqrnvfrcnvigvkncgksgvlqallgrnlmrqkkiredhksyyaintvyvygqeky
    lllhdiseseflteaeiicdvvclvydvsnpksfeycarifkqhfmdsripclivaaksd
    lhevkqeysisptdfcrkhkmpppqaftcntadapskdifvklttmamyphvtqadlkss
    tflehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kspA (A:)
    nvfrcnvigvkncgksgvlqallgrnlmrqkkirsyyaintvyvygqekylllhdisese
    flteaeiicdvvclvydvsnpksfeycarifkqhfmdsripclivaaksdlhevkqeysi
    sptdfcrkhkmpppqaftcntadapskdifvklttmamyp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kspB (B:)
    kkqtqrnvfrcnvigvkncgksgvlqallgrnlmrqkkiredhksyyaintvyvygqeky
    lllhdiseseflteaeiicdvvclvydvsnpksfeycarifkqhfmdsripclivaaksd
    lhevkqeysisptdfcrkhkmpppqaftcntadapskdifvklttmamyphvtqadlkss
    tflehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5kspB (B:)
    nvfrcnvigvkncgksgvlqallgrnlmrqksyyaintvyvygqekylllhdiseseflt
    eaeiicdvvclvydvsnpksfeycarifkqhfmdsripclivaaksdlhevkqeysispt
    dfcrkhkmpppqaftcntadapskdifvklttmam