PDB entry 5ksd

View 5ksd on RCSB PDB site
Description: crystal structure of a plasma membrane proton pump
Deposited on 2016-07-08, released 2016-08-10
The last revision was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATPase 2, plasma membrane-type
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AHA2, At4g30190, F9N11.40
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATPase 2, plasma membrane-type
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: AHA2, At4g30190, F9N11.40
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, K, ACP, LMT

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5ksdA (A:)
    vdlekipieevfqqlkcsreglttqegedriqifgpnkleekkeskllkflgfmwnplsw
    vmemaaimaialangdgrppdwqdfvgiicllvinstisfieennagnaaaalmaglapk
    tkvlrdgkwseqeaailvpgdivsiklgdiipadarllegdplkvdqsaltgeslpvtkh
    pgqevfsgstckqgeieavviatgvhtffgkaahlvdstnqvghfqkvltaignfcicsi
    aigmvieiivmypiqrrkyrdgidnllvlliggipiamptvlsvtmaigshrlsqqgait
    krmtaieemagmdvlcsdktgtltlnklsvdknlvevfckgvekdqvllfaamasrvenq
    daidaamvgmladpkearagirevhflpfnpvdkrtaltyidgsgnwhrvskgapeqile
    lakasndlskkvlsiidkyaerglrslavarqvvpektkespgapwefvgllplfdpprh
    dsaetirralnlgvnvkmitgdqlaigketgrrlgmgtnmypssallgthkdanlasipv
    eeliekadgfagvfpehkyeivkklqerkhivgmtgdgvndapalkkadigiavadatda
    argasdivltepglsviisavltsraifqrmknytiyavsitirivfgfmlialiwefdf
    safmvliiailndgtimtiskdrvkpsptpdswklkeifatgvvlggyqaimtviffwaa
    hktdffsdtfgvrsirdnnhelmgavylqvsiisqalifvtrsrswsfverpgallmiaf
    liaqliatliavyanwefakirgigwgwagviwlysivtyfpldvfkfairyi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >5ksdB (B:)
    vdlekipieevfqqlkcsreglttqegedriqifgpnkleekkeskllkflgfmwnplsw
    vmemaaimaialangdgrppdwqdfvgiicllvinstisfieennagnaaaalmaglapk
    tkvlrdgkwseqeaailvpgdivsiklgdiipadarllegdplkvdqsaltgeslpvtkh
    pgqevfsgstckqgeieavviatgvhtffgkaahlvdstnqvghfqkvltaignfcicsi
    aigmvieiivmypiqrrkyrdgidnllvlliggipiamptvlsvtmaigshrlsqqgait
    krmtaieemagmdvlcsdktgtltlnklsvdknlvevfckgvekdqvllfaamasrvenq
    daidaamvgmladpkearagirevhflpfnpvdkrtaltyidgsgnwhrvskgapeqile
    lakasndlskkvlsiidkyaerglrslavarqvvpektkespgapwefvgllplfdpprh
    dsaetirralnlgvnvkmitgdqlaigketgrrlgmgtnmypssallgthkdanlasipv
    eeliekadgfagvfpehkyeivkklqerkhivgmtgdgvndapalkkadigiavadatda
    argasdivltepglsviisavltsraifqrmknytiyavsitirivfgfmlialiwefdf
    safmvliiailndgtimtiskdrvkpsptpdswklkeifatgvvlggyqaimtviffwaa
    hktdffsdtfgvrsirdnnhelmgavylqvsiisqalifvtrsrswsfverpgallmiaf
    liaqliatliavyanwefakirgigwgwagviwlysivtyfpldvfkfairyi