PDB entry 5krp

View 5krp on RCSB PDB site
Description: Frutapin, a lectin from Artocarpus incisa: Cloning, Expressing and Structural Analysis.
Class: Carbohydrate Binding Protein
Keywords: Protein, Lectin, ApoFrutapin, Artocarpus altillis, Carbohydrate Binding Protein
Deposited on 2016-07-07, released 2017-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Frutapin
    Species: Artocarpus altilis [TaxId:194251]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KRP (0-149)
    Domains in SCOPe 2.07: d5krpa_
  • Chain 'B':
    Compound: Frutapin
    Species: Artocarpus altilis [TaxId:194251]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KRP (0-149)
    Domains in SCOPe 2.07: d5krpb_
  • Chain 'C':
    Compound: Frutapin
    Species: Artocarpus altilis [TaxId:194251]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KRP (0-149)
    Domains in SCOPe 2.07: d5krpc_
  • Chain 'D':
    Compound: Frutapin
    Species: Artocarpus altilis [TaxId:194251]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KRP (0-149)
    Domains in SCOPe 2.07: d5krpd_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5krpA (A:)
    masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
    lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
    fnlpienglvvgfkgrtgdlldaigvhmal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5krpB (B:)
    masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
    lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
    fnlpienglvvgfkgrtgdlldaigvhmal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5krpC (C:)
    masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
    lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
    fnlpienglvvgfkgrtgdlldaigvhmal
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5krpD (D:)
    masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
    lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
    fnlpienglvvgfkgrtgdlldaigvhmal