PDB entry 5kro

View 5kro on RCSB PDB site
Description: crystal structure of the er-alpha ligand-binding domain (y537s) in complex with the methyl(phenyl)amino-substituted estrogen, (8r,9s, 13s,14s,17s)-13-methyl-17-(methyl(phenyl)amino)-7,8,9,11,12,13,14,15, 16,17-decahydro-6h-cyclopenta[a]phenanthren-3-ol
Deposited on 2016-07-07, released 2017-01-18
The last revision was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (239)
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (239)
  • Chain 'C':
    Compound: ncoa2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KRO
  • Chain 'D':
    Compound: ncoa2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KRO
  • Heterogens: 6WW, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kroA (A:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records):
    >5kroA (A:)
    lalsltadqmvsalldaeppilyseyrpfseasmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytkdhihrvldkitdtlihlmakagltlqq
    qhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kroB (B:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records):
    >5kroB (B:)
    lalsltadqmvsalldaeppilyseydptrpseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqvegmveifdmll
    atssrfrmmnlqgeefvclksiillnsgvyteekdhihrvldkitdtlihlmakagltlq
    qqhqrlaqlllilshirhmsnkgmehlysmkcknvplsdlllemldah
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kroC (C:)
    khkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records):
    >5kroC (C:)
    kilhrllqd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kroD (D:)
    khkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records):
    >5kroD (D:)
    kilhrllqd