PDB entry 5krf

View 5krf on RCSB PDB site
Description: crystal structure of the er-alpha ligand-binding domain (y537s) in complex with the dynamic way derivative, 1a
Deposited on 2016-07-07, released 2017-02-15
The last revision was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (239)
  • Chain 'B':
    Compound: Estrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ESR1, ESR, NR3A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered mutation (239)
  • Chain 'C':
    Compound: KHKILHRLLQDSSS Peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KRF
  • Chain 'D':
    Compound: KHKILHRLLQDSSS Peptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KRF
  • Heterogens: 6WL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5krfA (A:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records):
    >5krfA (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytkdhihrvldkitdtlihlmakag
    ltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5krfB (B:)
    ikrskknslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhm
    inwakrvpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkc
    vegmveifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihr
    vldkitdtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvpls
    dlllemldahrlhapts
    

    Sequence, based on observed residues (ATOM records):
    >5krfB (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemldahrl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5krfC (C:)
    khkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records):
    >5krfC (C:)
    hkilhrllqd
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5krfD (D:)
    khkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records):
    >5krfD (D:)
    hkilhrllqd