PDB entry 5krb

View 5krb on RCSB PDB site
Description: gcnf dna binding domain - oct4 dr0 complex
Deposited on 2016-07-07, released 2016-11-09
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(*ap*gp*ap*gp*gp*tp*cp*ap*ap*gp*gp*cp*tp*ap*gp*a)-3')
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Chain 'B':
    Compound: Nuclear receptor subfamily 6 group A member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Nr6a1, Gcnf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64249 (0-End)
      • engineered mutation (32)
  • Chain 'E':
    Compound: DNA (5'-d(*tp*cp*tp*ap*gp*cp*cp*tp*tp*gp*ap*cp*cp*tp*cp*t)-3')
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Chain 'G':
    Compound: Nuclear receptor subfamily 6 group A member 1
    Species: Mus musculus [TaxId:10090]
    Gene: Nr6a1, Gcnf
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64249 (Start-83)
      • engineered mutation (32)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5krbB (B:)
    qrtclicgdratglhygiiscegckgffkrsisnkrvyrcsrdkncvmsrkqrnrcqycr
    llkclqmgmnrkairedgmpggrn
    

    Sequence, based on observed residues (ATOM records):
    >5krbB (B:)
    qrtclicgdratglhygiiscegckgffkrsisnkrvyrcsrdkncvmsrkqrnrcqycr
    llkclqmgmnrkai
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5krbG (G:)
    qrtclicgdratglhygiiscegckgffkrsisnkrvyrcsrdkncvmsrkqrnrcqycr
    llkclqmgmnrkairedgmpggrn
    

    Sequence, based on observed residues (ATOM records):
    >5krbG (G:)
    tclicgdratglhygiiscegckgffkrsisnkrvyrcsrdkncvmsrkqrnrcqycrll
    kclqmgmnrkairedgmpggrn