PDB entry 5kr7

View 5kr7 on RCSB PDB site
Description: KDM4C bound to pyrazolo-pyrimidine scaffold
Class: oxidoreductase
Keywords: inhibitor, histone, lysine demethylase, OXIDOREDUCTASE
Deposited on 2016-07-07, released 2016-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysine-specific demethylase 4c
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4C, GASC1, JHDM3C, JMJD2C, KIAA0780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kr7a_
  • Chain 'B':
    Compound: lysine-specific demethylase 4c
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4C, GASC1, JHDM3C, JMJD2C, KIAA0780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kr7b_
  • Heterogens: FE2, ZN, 6X9, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kr7A (A:)
    gshmasmtggqqmgrgsmevaevesplnpsckimtfrpsmeefrefnkylaymeskgahr
    aglakvippkewkprqcyddidnllipapiqqmvtgqsglftqyniqkkamtvkefrqla
    nsgkyctpryldyedlerkywknltfvapiygadingsiydegvdewniarlntvldvve
    eecgisiegvntpylyfgmwkttfawhtedmdlysinylhfgepkswyaippehgkrler
    laqgffpsssqgcdaflrhkmtlispsvlkkygipfdkitqeagefmitfpygyhagfnh
    gfncaestnfatvrwidygkvaklctcrkdmvkismdifvrkfqpdryqlwkqgkdiyti
    dhtkptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kr7A (A:)
    lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
    papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
    vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
    htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
    svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
    crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtkpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kr7B (B:)
    gshmasmtggqqmgrgsmevaevesplnpsckimtfrpsmeefrefnkylaymeskgahr
    aglakvippkewkprqcyddidnllipapiqqmvtgqsglftqyniqkkamtvkefrqla
    nsgkyctpryldyedlerkywknltfvapiygadingsiydegvdewniarlntvldvve
    eecgisiegvntpylyfgmwkttfawhtedmdlysinylhfgepkswyaippehgkrler
    laqgffpsssqgcdaflrhkmtlispsvlkkygipfdkitqeagefmitfpygyhagfnh
    gfncaestnfatvrwidygkvaklctcrkdmvkismdifvrkfqpdryqlwkqgkdiyti
    dhtkptp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kr7B (B:)
    lnpsckimtfrpsmeefrefnkylaymeskgahraglakvippkewkprqcyddidnlli
    papiqqmvtgqsglftqyniqkkamtvkefrqlansgkyctpryldyedlerkywknltf
    vapiygadingsiydegvdewniarlntvldvveeecgisiegvntpylyfgmwkttfaw
    htedmdlysinylhfgepkswyaippehgkrlerlaqgffpsssqgcdaflrhkmtlisp
    svlkkygipfdkitqeagefmitfpygyhagfnhgfncaestnfatvrwidygkvaklct
    crkdmvkismdifvrkfqpdryqlwkqgkdiytidhtkp