PDB entry 5kqz
View 5kqz on RCSB PDB site
Description: Protease E35D-CaP2
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, E35D, salt-bridge interaction, Natural polymorphism, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2016-07-06, released
2016-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-04, with a file datestamp of
2019-11-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot C8BD48 (0-98)
- conflict (6)
- conflict (24)
- conflict (32)
- conflict (62)
- conflict (66)
- conflict (94)
Domains in SCOPe 2.08: d5kqza_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Gene: pol
Database cross-references and differences (RAF-indexed):
- Uniprot C8BD48 (0-98)
- conflict (6)
- conflict (24)
- conflict (32)
- conflict (62)
- conflict (66)
- conflict (94)
Domains in SCOPe 2.08: d5kqzb_ - Heterogens: 0Q4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5kqzA (A:)
pqitlwkrplvtikiggqlkeallntgaddtviedmslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5kqzB (B:)
pqitlwkrplvtikiggqlkeallntgaddtviedmslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf