PDB entry 5kqz

View 5kqz on RCSB PDB site
Description: Protease E35D-CaP2
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, E35D, salt-bridge interaction, Natural polymorphism, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2016-07-06, released 2016-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-04, with a file datestamp of 2019-11-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot C8BD48 (0-98)
    • conflict (6)
    • conflict (24)
    • conflict (32)
    • conflict (62)
    • conflict (66)
    • conflict (94)
  Domains in SCOPe 2.08: d5kqza_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot C8BD48 (0-98)
    • conflict (6)
    • conflict (24)
    • conflict (32)
    • conflict (62)
    • conflict (66)
    • conflict (94)
  Domains in SCOPe 2.08: d5kqzb_
• Heterogens: 0Q4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5kqzA (A:)
  pqitlwkrplvtikiggqlkeallntgaddtviedmslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5kqzB (B:)
  pqitlwkrplvtikiggqlkeallntgaddtviedmslpgrwkpkmiggiggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf