PDB entry 5kqp

View 5kqp on RCSB PDB site
Description: Crystal structure of Apo-form LMW-PTP
Class: hydrolase
Keywords: lmw-ptp, hydrolase
Deposited on 2016-07-06, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-12, with a file datestamp of 2016-10-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Low molecular weight phosphotyrosine protein phosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: Acp1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kqpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kqpA (A:)
    mgsshhhhhhssglvprgshmaeqatksvlfvclgnicrspiaeavfrklvtdqnisenw
    rvdsaatsgyeignppdyrgqscmkrhgipmshvarqitkedfatfdyilcmdesnlrdl
    nrksnqvktckakiellgsydpqkqliiedpyygndsdfetvyqqcvrccraflekah
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kqpA (A:)
    atksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm
    krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk
    qliiedpyygndsdfetvyqqcvrccraflekah