PDB entry 5kqi

View 5kqi on RCSB PDB site
Description: Crystal structure of the L326D variant of catalase-peroxidase from B. pseudomallei
Class: oxidoreductase
Keywords: catalase, peroxidase, L326D, heme, OXIDOREDUCTASE
Deposited on 2016-07-06, released 2017-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JNW6 (Start-727)
      • engineered mutation (305)
    Domains in SCOPe 2.07: d5kqia1, d5kqia2
  • Chain 'B':
    Compound: Catalase-peroxidase
    Species: Burkholderia pseudomallei (strain 1710b) [TaxId:320372]
    Gene: katG, BURPS1710b_3366
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3JNW6 (Start-727)
      • engineered mutation (305)
    Domains in SCOPe 2.07: d5kqib1, d5kqib2
  • Heterogens: HEM, NA, CL, OXY, PO4, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kqiA (A:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsgdevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kqiA (A:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsgdevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kqiB (B:)
    msneakcpfhqaagngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaav
    krdlhalmttsqdwwpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswp
    dnanldkarrllwpikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedv
    ywgsekiwlelsggpnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdt
    farmamndeetvaliagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgad
    aitsgdevtwtttptqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskk
    hrptmlttdlslrfdpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp
    aevllwqdpipavdhplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrgga
    ngarirlapqkdweanqpeqlaavletleairtafngaqrggkqvsladlivlagcagve
    qaaknaghavtvpfapgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdk
    aqlltlsapemtvllgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaa
    dadvfegrdratgelkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvm
    nldrfdla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kqiB (B:)
    ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
    wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
    ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
    pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
    iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsgdevtwtttp
    tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
    dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaevllwqdpipavd
    hplidaadaaelkakvlasgltvsqlvstawaaastfrgsdkrggangarirlapqkdwe
    anqpeqlaavletleairtafngaqrggkqvsladlivlagcagveqaaknaghavtvpf
    apgradasqeqtdvesmavlepvadgfrnylkgkyrvpaevllvdkaqlltlsapemtvl
    lgglrvlganvgqsrhgvftareqaltndffvnlldmgtewkptaadadvfegrdratge
    lkwtgtrvdlvfgshsqlralaevygsadaqekfvrdfvavwnkvmnldrfdla