PDB entry 5kqa

View 5kqa on RCSB PDB site
Description: crystal structure of buckwheat glutaredoxin-glutathione complex
Deposited on 2016-07-06, released 2017-07-05
The last revision was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaredoxin-glutathione complex
    Species: Polygonaceae [TaxId:3615]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KQA
  • Heterogens: GSH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kqaA (A:)
    gstgplgsmgsvlssgqpteeqlkmalqkaqqlvnsnplvvfsktycgycsrvkklfdql
    garyqtieldqesdgdaiqaallqwtgqrtvpnvfiggkhiggcdsvmekhrdgklvpml
    tecgaiaiesta
    

    Sequence, based on observed residues (ATOM records):
    >5kqaA (A:)
    pteeqlkmalqkaqqlvnsnplvvfsktycgycsrvkklfdqlgaryqtieldqesdgda
    iqaallqwtgqrtvpnvfiggkhiggcdsvmekhrdgklvpmltecgaia