PDB entry 5kq1

View 5kq1 on RCSB PDB site
Description: Crystal structure of S. pombe Dcp1/Dcp2 in complex with H. sapiens PNRC2
Class: hydrolase
Keywords: decapping mRNA decay Nudix cap analog, HYDROLASE
Deposited on 2016-07-05, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mRNA-decapping enzyme subunit 1
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: dcp1, SPBC3B9.21
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: mRNA decapping complex subunit 2
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: dcp2, SPAC19A8.12
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13828 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d5kq1b1, d5kq1b2, d5kq1b3
  • Chain 'C':
    Compound: proline-rich nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PNRC2, HSPC208
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: mRNA-decapping enzyme subunit 1
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: dcp1, SPBC3B9.21
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: mRNA decapping complex subunit 2
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: dcp2, SPAC19A8.12
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13828 (5-End)
      • expression tag (4)
    Domains in SCOPe 2.07: d5kq1e1, d5kq1e2, d5kq1e3
  • Chain 'F':
    Compound: proline-rich nuclear receptor coactivator 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PNRC2, HSPC208
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kq1B (B:)
    ggggsmsftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndq
    lpslglrvfsaklfahcpllwkwskvheeafddflryktripvrgaimldmsmqqcvlvk
    gwkassgwgfpkgkidkdesdvdcairevyeetgfdcssrinpnefidmtirgqnvrlyi
    ipgisldtrfesrtrkeiskiewhnlmdlptfkknkpqtmknkfymvipflaplkkwikk
    rniannttk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kq1B (B:)
    smsftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpsl
    glrvfsaklfahcpllwkwskvheeafddflryktripvrgaimldmsmqqcvlvkgwka
    ssgwgfpkgkidkdesdvdcairevyeetgfdcssrinpnefidmtirgqnvrlyiipgi
    sldtrfesreiskiewhnlmdlptfkknkpmknkfymvipflaplkkwikkrnian
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5kq1E (E:)
    ggggsmsftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndq
    lpslglrvfsaklfahcpllwkwskvheeafddflryktripvrgaimldmsmqqcvlvk
    gwkassgwgfpkgkidkdesdvdcairevyeetgfdcssrinpnefidmtirgqnvrlyi
    ipgisldtrfesrtrkeiskiewhnlmdlptfkknkpqtmknkfymvipflaplkkwikk
    rniannttk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kq1E (E:)
    smsftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpsl
    glrvfsaklfahcpllwkwskvhafddflryktripvrgaimldmsmqqcvlvkgwkass
    gwgfpkgkidkdesdvdcairevyeetgfdcssrinpnefidmtirgqnvrlyiipgisl
    dtrfesrteiskiewhnlmdlptfkknkmknkfymvipflaplkkwikkrniann
    

  • Chain 'F':
    No sequence available.