PDB entry 5kpz

View 5kpz on RCSB PDB site
Description: PANK3-ADP-PhosphoPantothenate complex
Class: transferase
Keywords: PANK, Substrate, Complex, Transferase, Pantothenate kinase
Deposited on 2016-07-05, released 2016-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H999 (19-End)
      • expression tag (18)
    Domains in SCOPe 2.07: d5kpza1, d5kpza2, d5kpza3
  • Heterogens: PAZ, ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kpzA (A:)
    mgsshhhhhhssglvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyl
    tsnvaygstgirdvhlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlc
    atgggaykfekdfrtignlhlhkldeldclvkgllyidsvsfngqaecyyfanaseperc
    qkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfe
    ealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmiykekresvskedlara
    tlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalfle
    hegyfgavgallglpnfsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kpzA (A:)
    spwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyltsnvaygstgirdvhlel
    kdltlfgrrgnlhfirfptqdlptfiqmgrdknftvlcatgggaykfekdfrtignlhlh
    kldeldclvkgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgv
    silavhskdnykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiy
    ggdyerfglpgwavassfgnmiykekresvskedlaratlvtitnnigsvarmcavneki
    nrvvfvgnflrvntlsmkllayaldywskgqlkalflehegyfgavgallglpnf