PDB entry 5kpt

View 5kpt on RCSB PDB site
Description: PANK3-AMPPNP complex
Class: transferase
Keywords: PANK, Substrate, Complex, Transferase, Pantothenate kinase
Deposited on 2016-07-05, released 2016-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-10-26, with a file datestamp of 2016-10-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantothenate kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PANK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5kpta1, d5kpta2
  • Heterogens: MG, ANP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kptA (A:)
    mgsshhhhhhssglvprgspwfgmdiggtlvklsyfepiditaeeeqeeveslksirkyl
    tsnvaygstgirdvhlelkdltlfgrrgnlhfirfptqdlptfiqmgrdknfstlqtvlc
    atgggaykfekdfrtignlhlhkldeldclvkgllyidsvsfngqaecyyfanaseperc
    qkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslgggtflglcslltgcesfe
    ealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmiykekresvskedlara
    tlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllayaldywskgqlkalfle
    hegyfgavgallglpnfsdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kptA (A:)
    pwfgmdiggtlvklsyfepidieeveslksirkyltsnvaygstgirdvhlelkdltlfg
    rrgnlhfirfptqdlptfiqmgrdktvlcatgggaykfekdfrtignlhlhkldeldclv
    kgllyidsvsfngqaecyyfanasepercqkmpfnlddpypllvvnigsgvsilavhskd
    nykrvtgtslgggtflglcslltgcesfeealemaskgdstqadklvrdiyggdglpgwa
    vassfgnmiykekresvskedlaratlvtitnnigsvarmcavnekinrvvfvgnflrvn
    tlsmkllayaldywskgqlkalflehegyfgavgallglpnf