PDB entry 5kpm

View 5kpm on RCSB PDB site
Description: Glycogen Synthase Kinase 3 beta Complexed with BRD3731
Class: transferase/transferase inhibitor
Keywords: protein kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-07-04, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kpma_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kpmb_
  • Heterogens: 6VM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kpmA (A:)
    gspgmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kpmA (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffyssgdevylnlvldyvpetvyrvarhysrakqtlpviyv
    klymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyic
    sryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptr
    eqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahs
    ffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kpmB (B:)
    gspgmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kpmB (B:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffysskdevylnlvldyvpetvyrvarhysrakqtlpviyv
    klymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyic
    sryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptr
    eqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahs
    ffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari