PDB entry 5kpl

View 5kpl on RCSB PDB site
Description: Glycogen Synthase Kinase 3 beta Complexed with BRD0705
Class: transferase/transferase inhibitor
Keywords: protein kinase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-07-04, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kpla_
  • Chain 'B':
    Compound: Glycogen synthase kinase-3 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: GSK3B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kplb_
  • Heterogens: 6VL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kplA (A:)
    gspgmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kplA (A:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffysskkdevylnlvldyvpetvyrvarhysrakqtlpviy
    vklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyi
    csryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtpt
    reqiremnppqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelr
    dpnvklpngrdtpalfnfttqelssnpplatilipphari
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kplB (B:)
    gspgmsgrprttsfaesckpvqqpsafgsmkvsrdkdgskvttvvatpgqgpdrpqevsy
    tdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfknrelqimrkldhcnivrlryff
    yssgekkdevylnlvldyvpetvyrvarhysrakqtlpviyvklymyqlfrslayihsfg
    ichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyicsryyrapelifgatdyts
    sidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptreqiremnpnytefkfpqi
    kahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdelrdpnvklpngrdt
    palfnfttqelssnpplatilipphariqaaastptnataasdantgdrgqtnnaasasa
    snst
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kplB (B:)
    kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
    relqimrkldhcnivrlryffysskdevylnlvldyvpetvyrvarhysrakqtlpviyv
    klymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvsyic
    sryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgtptr
    eqiremnpnfpqikahpwtkvfrprtppeaialcsrlleytptarltpleacahsffdel
    rdpnvklpngrdtpalfnfttqelssnpplatilipphar