PDB entry 5kph

View 5kph on RCSB PDB site
Description: solution nmr structure of denovo beta sheet design protein, northeast structural genomics consortium (nesg) target or485
Deposited on 2016-07-04, released 2016-09-28
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: De novo Beta Sheet Design Protein OR485
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KPH (0-84)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5kphA (A:)
    mpseeeekrqvkqvakeklleqspnskvqvrrvqkqgntirvelelrtngkkenytveve
    rqgntwtvkritrtvgslehhhhhh