PDB entry 5kp1

View 5kp1 on RCSB PDB site
Description: Crystal Structure of Ketosteroid Isomerase from Pseudomonas putida (pKSI) bound to Equilenin; D40N, Y16(Cl-Y)
Class: isomerase
Keywords: Isomerase
Deposited on 2016-07-01, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (39)
    Domains in SCOPe 2.07: d5kp1a_
  • Chain 'B':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (39)
    Domains in SCOPe 2.07: d5kp1b_
  • Chain 'C':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (39)
    Domains in SCOPe 2.07: d5kp1c_
  • Chain 'D':
    Compound: steroid delta-isomerase
    Species: Pseudomonas putida [TaxId:303]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07445
      • engineered mutation (39)
    Domains in SCOPe 2.07: d5kp1d_
  • Heterogens: EQU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kp1A (A:)
    mnlptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepqlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kp1A (A:)
    lptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqglg
    ggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywse
    vnlsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kp1B (B:)
    mnlptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepqlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kp1B (B:)
    lptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqglg
    ggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywse
    vnlsv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kp1C (C:)
    mnlptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepqlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kp1C (C:)
    lptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqglg
    ggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywse
    vnlsvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kp1D (D:)
    mnlptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqg
    lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
    sevnlsvrepqlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kp1D (D:)
    lptaqevqglmarxielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqglg
    ggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywse
    vnlsv