PDB entry 5koz

View 5koz on RCSB PDB site
Description: Structure function studies of R. palustris RubisCO (K192C mutant; CABP-bound)
Class: lyase
Keywords: RubisCO, hexamer, LYASE
Deposited on 2016-07-01, released 2017-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5koza1, d5koza2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozb1, d5kozb2
  • Chain 'C':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozc1, d5kozc2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozd1, d5kozd2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5koze1, d5koze2
  • Chain 'F':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozf1, d5kozf2
  • Chain 'G':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozg1, d5kozg2
  • Chain 'H':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozh1, d5kozh2
  • Chain 'I':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozi1, d5kozi2
  • Chain 'J':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozj1, d5kozj2
  • Chain 'K':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozk1, d5kozk2
  • Chain 'L':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:1076]
    Gene: cbbM, RPA4641
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6N0W9 (20-End)
      • engineered mutation (211)
    Domains in SCOPe 2.06: d5kozl1, d5kozl2
  • Heterogens: CAP, MG, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kozA (A:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozA (A:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kozB (B:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozB (B:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kozC (C:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozC (C:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kozD (D:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozD (D:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrakl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5kozE (E:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozE (E:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5kozF (F:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozF (F:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5kozG (G:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozG (G:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5kozH (H:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozH (H:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5kozI (I:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozI (I:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5kozJ (J:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozJ (J:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5kozK (K:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozK (K:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrakl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5kozL (L:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdficndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kozL (L:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdficndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwrak