PDB entry 5koy

View 5koy on RCSB PDB site
Description: mouse pgp 34 linker deleted bound with atp
Deposited on 2016-07-01, released 2016-12-14
The last revision was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 3.85 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multidrug resistance protein 1a
    Species: Mus musculus [TaxId:10090]
    Gene: Abcb1a, Abcb4, Mdr1a, Mdr3, Pgy-3, Pgy3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21447
      • engineered mutation (551)
      • conflict (1162)
  • Chain 'B':
    Compound: Multidrug resistance protein 1a
    Species: Mus musculus [TaxId:10090]
    Gene: Abcb1a, Abcb4, Mdr1a, Mdr3, Pgy-3, Pgy3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21447
      • engineered mutation (551)
      • conflict (1162)
  • Heterogens: ATP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5koyA (A:)
    meleedlkgradknfskmgkkskkekkekkpavsvltmfryagwldrlymlvgtlaaiih
    gvalplmmlifgdmtdsfasvgnvsknstnmseadkramfakleeemttyayyytgigag
    vlivayiqvsfwclaagrqihkirqkffhaimnqeigwfdvhdvgelntrltddvskine
    gigdkigmffqamatffggfiigftrgwkltlvilaispvlglsagiwakilssftdkel
    hayakagavaeevlaairtviafggqkkelerynnnleeakrlgikkaitanismgaafl
    liyasyalafwygtslviskeysigqvltvffsvligafsvgqaspnieafanargaaye
    vfkiidnkpsidsfsksghkpdniqgnlefknihfsypsrkevqilkglnlkvksgqtva
    lvgnsgcgksttvqlmqrlydpldgmvsidgqdirtinvrylreiigvvsqepvlfatti
    aenirygredvtmdeiekavkeanaydfimklphqfdtlvgergaqlsggqkqriaiara
    lvrnpkillldqatsaldteseavvqaaldkaregrttiviahrlstvrnadviagfdgg
    viveqgnhdelmrekgiyfklvmtqtagneielgneackskdeidnldaldedvppasfw
    rilklnstewpyfvvgifcaiingglqpafsvifskvvgvftnggppetqrqnsnlfsll
    flilgiisfitfflqgftfgkageiltkrlrymvfksmlrqdvswfddpknttgalttrl
    andaaqvkgatgsrlavifqnianlgtgiiisliygwqltllllaivpiiaiagvvemkm
    lsgqalkdkkelegsgkiateaienfrtvvsltreqkfetmyaqslqipyrnamkkahvf
    gitfsftqammyfsyaacfrfgaylvtqqlmtfenvllvfsaivfgamavgqvssfapdy
    akatvsashiiriiektpeidsystqglkpnmlegnvqfsgvvfnyptrpsipvlqglsl
    evkkgqtlalvgssgcgkstvvqllerfydpmagsvfldgkeikqlnvqwlraqlgivsq
    epilfdcsiaeniaygdnsrvvsyeeivraakeanihqfidslpdkyntrvgdkgtqlsg
    gqkqriaiaralvrqphillldqatsaldtesekvvqealdkaregrtciviahrlstiq
    nadlivviqngkvkehgthqqllaqkgiyfsmvsvqagakrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5koyA (A:)
    pavsvltmfryagwldrlymlvgtlaaiihgvalplmmlifgdmtdsfasvgnvsknstn
    mseadkramfakleeemttyayyytgigagvlivayiqvsfwclaagrqihkirqkffha
    imnqeigwfdvhdvgelntrltddvskinegigdkigmffqamatffggfiigftrgwkl
    tlvilaispvlglsagiwakilssftdkelhayakagavaeevlaairtviafggqkkel
    erynnnleeakrlgikkaitanismgaaflliyasyalafwygtslviskeysigqvltv
    ffsvligafsvgqaspnieafanargaayevfkiidnkpsidsfsksghkpdniqgnlef
    knihfsypsrkevqilkglnlkvksgqtvalvgnsgcgksttvqlmqrlydpldgmvsid
    gqdirtinvrylreiigvvsqepvlfattiaenirygredvtmdeiekavkeanaydfim
    klphqfdtlvgergaqlsggqkqriaiaralvrnpkillldqatsaldteseavvqaald
    karegrttiviahrlstvrnadviagfdggviveqgnhdelmrekgiyfklvmtqtdvpp
    asfwrilklnstewpyfvvgifcaiingglqpafsvifskvvgvftnggppetqrqnsnl
    fsllflilgiisfitfflqgftfgkageiltkrlrymvfksmlrqdvswfddpknttgal
    ttrlandaaqvkgatgsrlavifqnianlgtgiiisliygwqltllllaivpiiaiagvv
    emkmlsgqalkdkkelegsgkiateaienfrtvvsltreqkfetmyaqslqipyrnamkk
    ahvfgitfsftqammyfsyaacfrfgaylvtqqlmtfenvllvfsaivfgamavgqvssf
    apdyakatvsashiiriiektpeidsystqglkpnmlegnvqfsgvvfnyptrpsipvlq
    glslevkkgqtlalvgssgcgkstvvqllerfydpmagsvfldgkeikqlnvqwlraqlg
    ivsqepilfdcsiaeniaygdnsrvvsyeeivraakeanihqfidslpdkyntrvgdkgt
    qlsggqkqriaiaralvrqphillldqatsaldtesekvvqealdkaregrtciviahrl
    stiqnadlivviqngkvkehgthqqllaqkgiyfsmvsvqag
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5koyB (B:)
    meleedlkgradknfskmgkkskkekkekkpavsvltmfryagwldrlymlvgtlaaiih
    gvalplmmlifgdmtdsfasvgnvsknstnmseadkramfakleeemttyayyytgigag
    vlivayiqvsfwclaagrqihkirqkffhaimnqeigwfdvhdvgelntrltddvskine
    gigdkigmffqamatffggfiigftrgwkltlvilaispvlglsagiwakilssftdkel
    hayakagavaeevlaairtviafggqkkelerynnnleeakrlgikkaitanismgaafl
    liyasyalafwygtslviskeysigqvltvffsvligafsvgqaspnieafanargaaye
    vfkiidnkpsidsfsksghkpdniqgnlefknihfsypsrkevqilkglnlkvksgqtva
    lvgnsgcgksttvqlmqrlydpldgmvsidgqdirtinvrylreiigvvsqepvlfatti
    aenirygredvtmdeiekavkeanaydfimklphqfdtlvgergaqlsggqkqriaiara
    lvrnpkillldqatsaldteseavvqaaldkaregrttiviahrlstvrnadviagfdgg
    viveqgnhdelmrekgiyfklvmtqtagneielgneackskdeidnldaldedvppasfw
    rilklnstewpyfvvgifcaiingglqpafsvifskvvgvftnggppetqrqnsnlfsll
    flilgiisfitfflqgftfgkageiltkrlrymvfksmlrqdvswfddpknttgalttrl
    andaaqvkgatgsrlavifqnianlgtgiiisliygwqltllllaivpiiaiagvvemkm
    lsgqalkdkkelegsgkiateaienfrtvvsltreqkfetmyaqslqipyrnamkkahvf
    gitfsftqammyfsyaacfrfgaylvtqqlmtfenvllvfsaivfgamavgqvssfapdy
    akatvsashiiriiektpeidsystqglkpnmlegnvqfsgvvfnyptrpsipvlqglsl
    evkkgqtlalvgssgcgkstvvqllerfydpmagsvfldgkeikqlnvqwlraqlgivsq
    epilfdcsiaeniaygdnsrvvsyeeivraakeanihqfidslpdkyntrvgdkgtqlsg
    gqkqriaiaralvrqphillldqatsaldtesekvvqealdkaregrtciviahrlstiq
    nadlivviqngkvkehgthqqllaqkgiyfsmvsvqagakrshhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5koyB (B:)
    pavsvltmfryagwldrlymlvgtlaaiihgvalplmmlifgdmtdsfasvgnvsknstn
    mseadkramfakleeemttyayyytgigagvlivayiqvsfwclaagrqihkirqkffha
    imnqeigwfdvhdvgelntrltddvskinegigdkigmffqamatffggfiigftrgwkl
    tlvilaispvlglsagiwakilssftdkelhayakagavaeevlaairtviafggqkkel
    erynnnleeakrlgikkaitanismgaaflliyasyalafwygtslviskeysigqvltv
    ffsvligafsvgqaspnieafanargaayevfkiidnkpsidsfsksghkpdniqgnlef
    knihfsypsrkevqilkglnlkvksgqtvalvgnsgcgksttvqlmqrlydpldgmvsid
    gqdirtinvrylreiigvvsqepvlfattiaenirygredvtmdeiekavkeanaydfim
    klphqfdtlvgergaqlsggqkqriaiaralvrnpkillldqatsaldteseavvqaald
    karegrttiviahrlstvrnadviagfdggviveqgnhdelmrekgiyfklvmtqtdvpp
    asfwrilklnstewpyfvvgifcaiingglqpafsvifskvvgvftnggppetqrqnsnl
    fsllflilgiisfitfflqgftfgkageiltkrlrymvfksmlrqdvswfddpknttgal
    ttrlandaaqvkgatgsrlavifqnianlgtgiiisliygwqltllllaivpiiaiagvv
    emkmlsgqalkdkkelegsgkiateaienfrtvvsltreqkfetmyaqslqipyrnamkk
    ahvfgitfsftqammyfsyaacfrfgaylvtqqlmtfenvllvfsaivfgamavgqvssf
    apdyakatvsashiiriiektpeidsystqglkpnmlegnvqfsgvvfnyptrpsipvlq
    glslevkkgqtlalvgssgcgkstvvqllerfydpmagsvfldgkeikqlnvqwlraqlg
    ivsqepilfdcsiaeniaygdnsrvvsyeeivraakeanihqfidslpdkyntrvgdkgt
    qlsggqkqriaiaralvrqphillldqatsaldtesekvvqealdkaregrtciviahrl
    stiqnadlivviqngkvkehgthqqllaqkgiyfsmvsvqa