PDB entry 5kog

View 5kog on RCSB PDB site
Description: chromodomain hp1 with y24f mutation bound to histone h3 peptide containing trimethyl lysine
Deposited on 2016-06-30, released 2017-12-06
Made obsolete by 6asz on 2019-03-27

The last revision was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterochromatin protein 1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Su(var)205, HP1, CG8409
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05205
      • engineered mutation (16)
      • engineered mutation (30)
  • Chain 'P':
    Compound: trimethyl lysine histone H3 tail peptide
    Species: DROSOPHILA MELANOGASTER, synthetic [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KOG (0-5)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kogA (A:)
    mkkhhhhhhaeeeeeefavekiidrrvrkgmveyylkwkgypetentwepennldcqdli
    qqyeasrkd
    

    Sequence, based on observed residues (ATOM records):
    >5kogA (A:)
    eefavekiidrrvrkgmveyylkwkgypetentwepennldcqdliqqyeasr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >5kogP (P:)
    qtarks