PDB entry 5kof

View 5kof on RCSB PDB site
Description: Crosslinked Crystal Structure of Type II Fatty Acid Synthase Ketosynthase, FabB, and Acyl Carrier Protein, AcpP
Class: transferase
Keywords: crosslinked, ketosynthase, ACP, complex, TRANSFERASE
Deposited on 2016-06-30, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A954 (1-406)
      • expression tag (0)
    Domains in SCOPe 2.07: d5kofa1, d5kofa2, d5kofa3
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] synthase 1
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kofb1, d5kofb2
  • Chain 'C':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kofc_
  • Chain 'D':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kofd_
  • Heterogens: 6W5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kofA (A:)
    amkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgl
    idrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgada
    mrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiql
    gkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvv
    veelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshg
    tstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsi
    nieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kofB (B:)
    amkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgl
    idrkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgada
    mrgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiql
    gkqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvv
    veelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshg
    tstpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsi
    nieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kofB (B:)
    mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kofC (C:)
    mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
    ekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kofC (C:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyingh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kofD (D:)
    mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
    ekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kofD (D:)
    mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
    ekittvqaaidyingh